PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G075000.1
Common NameB456_001G075000, LOC105787960
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 263aa    MW: 30283 Da    PI: 6.7249
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G075000.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.82.2e-171764148
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                        rg W++eEd ll++++ ++G g+W++ a++ g++Rt+k+c++rw++yl
  Gorai.001G075000.1 17 RGTWSAEEDSLLIHYIGLHGEGHWNLLAKRAGLRRTGKSCRLRWLNYL 64
                        89********************************************97 PP

2Myb_DNA-binding48.61.9e-1571113246
                         SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         g+ T++E+ l+++++ ++G++ W++Ia++++ gRt++++k++w++
  Gorai.001G075000.1  71 GNLTPQEECLILQLHSKWGNR-WSKIAKYLP-GRTDNEIKNYWRT 113
                         678******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.9181268IPR017930Myb domain
SuperFamilySSF466894.87E-3015111IPR009057Homeodomain-like
SMARTSM007174.7E-151666IPR001005SANT/Myb domain
PfamPF002493.9E-161764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.4E-221871IPR009057Homeodomain-like
CDDcd001671.98E-111964No hitNo description
SMARTSM007172.7E-1569117IPR001005SANT/Myb domain
PROSITE profilePS5129419.40169119IPR017930Myb domain
PfamPF002491.6E-1471113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.5E-2372117IPR009057Homeodomain-like
CDDcd001672.47E-1274113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MLSYTNSSKG DAEQLRRGTW SAEEDSLLIH YIGLHGEGHW NLLAKRAGLR RTGKSCRLRW  60
LNYLKPDVKH GNLTPQEECL ILQLHSKWGN RWSKIAKYLP GRTDNEIKNY WRTRVNKHAR  120
HLKIDANSTP FQHVIRCCNW MPRLLPEMES LNQTSQHDQE LLTMEQVPVQ EQISGSTDIM  180
STISQVAEYQ TSPFSIISNN DDYALAKYCY HDDNIDKNCC YYNLASTSAF EDFPYLVGDC  240
HKPDYNCVND GFADGLWSMG EQ*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-23151175106B-MYB
1gv2_A1e-2314111197MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-231411124120MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012470048.10.0PREDICTED: transcription factor MYB108-like
SwissprotQ9LDE15e-57MY108_ARATH; Transcription factor MYB108
TrEMBLA0A0D2N6N10.0A0A0D2N6N1_G
STRINGVIT_17s0000g03560.t014e-91(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2236045
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68320.11e-69myb domain protein 62
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]